PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G265300.2
Common NameB456_013G265300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 185aa    MW: 21192.6 Da    PI: 5.107
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G265300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T++E++l +++++++G++ W++Iar+++ gRt++++k++w++++
  Gorai.013G265300.2  2 TPQEEKLVLELHAKWGNR-WSRIARRLP-GRTDNEIKNFWRTHM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001673.53E-12143No hitNo description
SMARTSM007171.2E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129422.984147IPR017930Myb domain
PfamPF002493.4E-15242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-20244IPR009057Homeodomain-like
SuperFamilySSF466891.56E-12248IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MTPQEEKLVL ELHAKWGNRW SRIARRLPGR TDNEIKNFWR THMRKMALEK KRSTSPSSSS  60
SSTVTRVDSL PSSGTGKVSF YDTGGPKMAV FDDIKGYSMD EIWKDIDMSE GNTTKLPLSE  120
NYSEQGCCNH FSCPSMASSP PWDFSWDYSL WKMDDDDDDD DEEERKVFIA TTNNQLFNLF  180
VHKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6165210.0JX616521.1 Gossypium hirsutum clone NBRI_GE61253 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464122.11e-135PREDICTED: transcription factor MYB59-like
SwissprotQ9LX823e-44MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D2VKJ91e-136A0A0D2VKJ9_G
STRINGVIT_06s0004g04140.t018e-49(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-42myb domain protein 48
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]